PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01409.1.g00120.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 192aa    MW: 21489.2 Da    PI: 10.6532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01409.1.g00120.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.32.1e-092254133
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgk 33
                                  +g W++eEd++l + ++++G  tW+++a+  gk
  Zpz_sc01409.1.g00120.1.am.mk 22 KGLWSPEEDDRLFNQITLHGVSTWSSVAQLAGK 54
                                  678****************************93 PP

2Myb_DNA-binding43.57.4e-1471112346
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   + ++ E+e ++ + + lG++ W++Ia++m+ gRt++++k++w++
  Zpz_sc01409.1.g00120.1.am.mk  71 PISKREEEVIISLQRSLGNR-WSAIAAKMP-GRTDNEIKNYWNS 112
                                   56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.4111755IPR017877Myb-like domain
SuperFamilySSF466891.04E-1821110IPR009057Homeodomain-like
SMARTSM007172.62166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-82154IPR009057Homeodomain-like
PfamPF002492.3E-62255IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2064118IPR009057Homeodomain-like
PROSITE profilePS5129420.36264118IPR017930Myb domain
SMARTSM007171.1E-1268116IPR001005SANT/Myb domain
PfamPF002491.3E-1171112IPR001005SANT/Myb domain
CDDcd001672.12E-971111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MVRKPSHDDA GRPGTGENKE RKGLWSPEED DRLFNQITLH GVSTWSSVAQ LAGKKITSHF  60
HWCLPGLKKE PISKREEEVI ISLQRSLGNR WSAIAAKMPG RTDNEIKNYW NSRIRKRLNP  120
AAKPGRARAA GNSAEEPVPA AERTEESTDK AGTSAHPGAS SITRRTCSWM YPASWTRGRG  180
DLYWVNPMRS VN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-172211827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.12e-58PREDICTED: transcription factor MYB82-like
SwissprotP200271e-31MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3XL222e-58K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m6e-58(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-31myb domain protein 86